Description
| LL-37 5MG | |
|---|---|
| SKU | CP_LL_37_5MG_3ML_VIAL |
| CATEGORY | Bioregulator Peptide |
| CAS | 154947-66-7 |
| VIAL SIZE | 3 mL |
| FORM | LYOPHILIZED POWDER (trifluoroacetate salt) |
| MOLECULAR WEIGHT | 4493.34 g/mol |
| SEQUENCE | [LL-37, 37 aa] |
| MOLECULAR FORMULA | C205H340N60O53 |
| ITEM ID | 17044 |
Szarszoń et al. (2026) characterized Cu(II) and Zn(II) coordination chemistry of LL-37, its C-terminal fragment DF-12, and an all-D stereoisomer analogue (df-12) using potentiometric, spectroscopic, and microbiological methods. At physiological pH, both metal ions bound through the N-terminal amino group and a carboxylate donor, with divergent coordination pathways at higher pH. LL-37 retained its α-helical conformation upon metal binding. In antimicrobial and antibiofilm plate assays, full-length LL-37 displayed the broadest activity spectrum among the tested peptides. Truncation altered antibacterial assay outcomes, although DF-12 and df-12 showed measurable antifungal and antibiofilm activity with low cytotoxicity in the cell models tested [42708248].
